Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 11(PCR11)
Volume: 50 ug. Other sizes are also available. Please Inquire.
Product Type: Recombinant Protein
Species: Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.: Q9SX24
Tag Info: The tag type will be determined during production process.
Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence: MNLSSNDQPSQGRIKAKDWSTDLCECWMDINSCCLTCWCPCVAFGRIAEVVDRGSTSCGV SGAMYMIIFMLTGYGGSSLYSCFYRTKLRAQYNLKERPCCDCCVHFCCEPCALCQEYRQL QHNRDLDLVIGWHGNMERHARLAASTPSAPPLQAPMSRLV
Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 11 Short name= AtPCR11
Gene Names: Name: PCR11 Ordered Locus Names: At1g68610 ORF Names: F24J5.15
Expression Region: 1-160
Sequence Info: full length protein