Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 2(PCR2)
Volume: 50 ug. Other sizes are also available. Please Inquire.
Product Type: Recombinant Protein
Species: Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.: Q9LQU4
Tag Info: The tag type will be determined during production process.
Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence: MEAQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGA LYALIAVVTGCACIYSCFYRGKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYRELKHRGY DMSLGWAGNVERQQNQGGVAMGAPVFQGGMTR
Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 2 Short name= AtPCR2
Gene Names: Name: PCR2 Ordered Locus Names: At1g14870 ORF Names: F10B6.27
Expression Region: 1-152
Sequence Info: full length protein